Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00007458-M07 |
Product name: | WBSCR1 monoclonal antibody (M07), clone 4B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant WBSCR1. |
Clone: | 4B2 |
Isotype: | IgG2a Kappa |
Gene id: | 7458 |
Gene name: | EIF4H |
Gene alias: | KIAA0038|WBSCR1|WSCR1 |
Gene description: | eukaryotic translation initiation factor 4H |
Genbank accession: | NM_031992 |
Immunogen: | WBSCR1 (NP_114381.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALT |
Protein accession: | NP_114381.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of WBSCR1 expression in transfected 293T cell line by WBSCR1 monoclonal antibody (M07), clone 4B2. Lane 1: WBSCR1 transfected lysate(27.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |