WBSCR1 monoclonal antibody (M07), clone 4B2 View larger

WBSCR1 monoclonal antibody (M07), clone 4B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WBSCR1 monoclonal antibody (M07), clone 4B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about WBSCR1 monoclonal antibody (M07), clone 4B2

Brand: Abnova
Reference: H00007458-M07
Product name: WBSCR1 monoclonal antibody (M07), clone 4B2
Product description: Mouse monoclonal antibody raised against a partial recombinant WBSCR1.
Clone: 4B2
Isotype: IgG2a Kappa
Gene id: 7458
Gene name: EIF4H
Gene alias: KIAA0038|WBSCR1|WSCR1
Gene description: eukaryotic translation initiation factor 4H
Genbank accession: NM_031992
Immunogen: WBSCR1 (NP_114381.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALT
Protein accession: NP_114381.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007458-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007458-M07-13-15-1.jpg
Application image note: Western Blot analysis of WBSCR1 expression in transfected 293T cell line by WBSCR1 monoclonal antibody (M07), clone 4B2.

Lane 1: WBSCR1 transfected lysate(27.4 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WBSCR1 monoclonal antibody (M07), clone 4B2 now

Add to cart