WARS monoclonal antibody (M02), clone 3A12 View larger

WARS monoclonal antibody (M02), clone 3A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WARS monoclonal antibody (M02), clone 3A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re,WB-Tr,IP

More info about WARS monoclonal antibody (M02), clone 3A12

Brand: Abnova
Reference: H00007453-M02
Product name: WARS monoclonal antibody (M02), clone 3A12
Product description: Mouse monoclonal antibody raised against a partial recombinant WARS.
Clone: 3A12
Isotype: IgG2a Kappa
Gene id: 7453
Gene name: WARS
Gene alias: GAMMA-2|IFI53|IFP53
Gene description: tryptophanyl-tRNA synthetase
Genbank accession: NM_004184
Immunogen: WARS (NP_004175, 50 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDA
Protein accession: NP_004175
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007453-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007453-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to WARS on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy WARS monoclonal antibody (M02), clone 3A12 now

Add to cart