VSNL1 monoclonal antibody (M01), clone 2F1-E3 View larger

VSNL1 monoclonal antibody (M01), clone 2F1-E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VSNL1 monoclonal antibody (M01), clone 2F1-E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about VSNL1 monoclonal antibody (M01), clone 2F1-E3

Brand: Abnova
Reference: H00007447-M01
Product name: VSNL1 monoclonal antibody (M01), clone 2F1-E3
Product description: Mouse monoclonal antibody raised against a full length recombinant VSNL1.
Clone: 2F1-E3
Isotype: IgG2a kappa
Gene id: 7447
Gene name: VSNL1
Gene alias: HLP3|HPCAL3|HUVISL1|VILIP|VILIP-1
Gene description: visinin-like 1
Genbank accession: BC022012
Immunogen: VSNL1 (AAH22012, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Protein accession: AAH22012
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007447-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.75 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007447-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged VSNL1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VSNL1 monoclonal antibody (M01), clone 2F1-E3 now

Add to cart