VRK1 monoclonal antibody (M02), clone 4F9 View larger

VRK1 monoclonal antibody (M02), clone 4F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VRK1 monoclonal antibody (M02), clone 4F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab

More info about VRK1 monoclonal antibody (M02), clone 4F9

Brand: Abnova
Reference: H00007443-M02
Product name: VRK1 monoclonal antibody (M02), clone 4F9
Product description: Mouse monoclonal antibody raised against a partial recombinant VRK1.
Clone: 4F9
Isotype: IgG2a Kappa
Gene id: 7443
Gene name: VRK1
Gene alias: MGC117401|MGC138280|MGC142070
Gene description: vaccinia related kinase 1
Genbank accession: NM_003384
Immunogen: VRK1 (NP_003375, 287 a.a. ~ 396 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
Protein accession: NP_003375
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007443-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007443-M02-42-R01V-1.jpg
Application image note: Western blot analysis of VRK1 over-expressed 293 cell line, cotransfected with VRK1 Validated Chimera RNAi ( Cat # H00007443-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with VRK1 monoclonal antibody (M02) clone 4F9 (Cat # H00007443-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy VRK1 monoclonal antibody (M02), clone 4F9 now

Add to cart