Brand: | Abnova |
Reference: | H00007442-M02 |
Product name: | TRPV1 monoclonal antibody (M02), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRPV1. |
Clone: | 1A8 |
Isotype: | IgG2a Kappa |
Gene id: | 7442 |
Gene name: | TRPV1 |
Gene alias: | DKFZp434K0220|VR1 |
Gene description: | transient receptor potential cation channel, subfamily V, member 1 |
Genbank accession: | NM_080706 |
Immunogen: | TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ |
Protein accession: | NP_542437 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TRPV1 is 0.03 ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Nerve growth factor rescues diabetic mice heart after ischemia/reperfusion injury via up-regulation of the TRPV1 receptor.Zheng LR, Zhang YY, Han J, Sun ZW, Zhou SX, Zhao WT, Wang LH. J Diabetes Complications. 2015 Apr;29(3):323-8. |