H00007442-M01A_200uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00007442-M01A |
Product name: | TRPV1 monoclonal antibody (M01A), clone 1F5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRPV1. |
Clone: | 1F5 |
Isotype: | IgG1 Kappa |
Gene id: | 7442 |
Gene name: | TRPV1 |
Gene alias: | DKFZp434K0220|VR1 |
Gene description: | transient receptor potential cation channel, subfamily V, member 1 |
Genbank accession: | NM_080706 |
Immunogen: | TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ |
Protein accession: | NP_542437 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |