TRPV1 polyclonal antibody (A01) View larger

TRPV1 polyclonal antibody (A01)

H00007442-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRPV1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TRPV1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00007442-A01
Product name: TRPV1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TRPV1.
Gene id: 7442
Gene name: TRPV1
Gene alias: DKFZp434K0220|VR1
Gene description: transient receptor potential cation channel, subfamily V, member 1
Genbank accession: NM_080706
Immunogen: TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
Protein accession: NP_542437
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007442-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TRPV1 polyclonal antibody (A01) now

Add to cart