VMD2 monoclonal antibody (M01), clone 1C2 View larger

VMD2 monoclonal antibody (M01), clone 1C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VMD2 monoclonal antibody (M01), clone 1C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about VMD2 monoclonal antibody (M01), clone 1C2

Brand: Abnova
Reference: H00007439-M01
Product name: VMD2 monoclonal antibody (M01), clone 1C2
Product description: Mouse monoclonal antibody raised against a partial recombinant VMD2.
Clone: 1C2
Isotype: IgG1 Kappa
Gene id: 7439
Gene name: BEST1
Gene alias: ARB|BEST|BMD|TU15B|VMD2
Gene description: bestrophin 1
Genbank accession: BC041664
Immunogen: VMD2 (AAH41664, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESD
Protein accession: AAH41664
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007439-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VMD2 monoclonal antibody (M01), clone 1C2 now

Add to cart