Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of VIPR2 monoclonal antibody (M01), clone 2E3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about VIPR2 monoclonal antibody (M01), clone 2E3
| Brand: | Abnova |
| Reference: | H00007434-M01 |
| Product name: | VIPR2 monoclonal antibody (M01), clone 2E3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant VIPR2. |
| Clone: | 2E3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7434 |
| Gene name: | VIPR2 |
| Gene alias: | FLJ16511|VPAC2|VPCAP2R |
| Gene description: | vasoactive intestinal peptide receptor 2 |
| Genbank accession: | NM_003382 |
| Immunogen: | VIPR2 (NP_003373, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILV |
| Protein accession: | NP_003373 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | VIPR2 monoclonal antibody (M01), clone 2E3. Western Blot analysis of VIPR2 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | VIP impairs acquisition of the macrophage proinflammatory polarization profile.Carrion M, Perez-Garcia S, Martinez C, Juarranz Y, Estrada-Capetillo L, Puig-Kroger A, Gomariz RP, Gutierrez-Canas I. J Leukoc Biol. 2016 Dec;100(6):1385-1393. Epub 2016 Jul 5. |