Brand: | Abnova |
Reference: | H00007434-A01 |
Product name: | VIPR2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant VIPR2. |
Gene id: | 7434 |
Gene name: | VIPR2 |
Gene alias: | FLJ16511|VPAC2|VPCAP2R |
Gene description: | vasoactive intestinal peptide receptor 2 |
Genbank accession: | NM_003382 |
Immunogen: | VIPR2 (NP_003373, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILV |
Protein accession: | NP_003373 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | VIPR2 polyclonal antibody (A01), Lot # 050926JC01 Western Blot analysis of VIPR2 expression in U-2 OS ( Cat # L022V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |