VIL1 monoclonal antibody (M02), clone 3G6 View larger

VIL1 monoclonal antibody (M02), clone 3G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VIL1 monoclonal antibody (M02), clone 3G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about VIL1 monoclonal antibody (M02), clone 3G6

Brand: Abnova
Reference: H00007429-M02
Product name: VIL1 monoclonal antibody (M02), clone 3G6
Product description: Mouse monoclonal antibody raised against a partial recombinant VIL1.
Clone: 3G6
Isotype: IgG2b Kappa
Gene id: 7429
Gene name: VIL1
Gene alias: D2S1471|VIL
Gene description: villin 1
Genbank accession: NM_007127
Immunogen: VIL1 (NP_009058, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGA
Protein accession: NP_009058
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007429-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged VIL1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy VIL1 monoclonal antibody (M02), clone 3G6 now

Add to cart