VHL monoclonal antibody (M01), clone 1G12 View larger

VHL monoclonal antibody (M01), clone 1G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VHL monoclonal antibody (M01), clone 1G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about VHL monoclonal antibody (M01), clone 1G12

Brand: Abnova
Reference: H00007428-M01
Product name: VHL monoclonal antibody (M01), clone 1G12
Product description: Mouse monoclonal antibody raised against a partial recombinant VHL.
Clone: 1G12
Isotype: IgG2b Kappa
Gene id: 7428
Gene name: VHL
Gene alias: HRCA1|RCA1|VHL1
Gene description: von Hippel-Lindau tumor suppressor
Genbank accession: NM_000551
Immunogen: VHL (NP_000542, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIH
Protein accession: NP_000542
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007428-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007428-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged VHL is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VHL monoclonal antibody (M01), clone 1G12 now

Add to cart