Brand: | Abnova |
Reference: | H00007423-M03 |
Product name: | VEGFB monoclonal antibody (M03), clone 4H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VEGFB. |
Clone: | 4H5 |
Isotype: | IgG2b Kappa |
Gene id: | 7423 |
Gene name: | VEGFB |
Gene alias: | VEGFL|VRF |
Gene description: | vascular endothelial growth factor B |
Genbank accession: | NM_003377 |
Immunogen: | VEGFB (NP_003368, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPD |
Protein accession: | NP_003368 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of VEGFB transfected lysate using anti-VEGFB monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with VEGFB MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |