Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00007417-M01 |
Product name: | VDAC2 monoclonal antibody (M01), clone 3D2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant VDAC2. |
Clone: | 3D2 |
Isotype: | IgG2a Kappa |
Gene id: | 7417 |
Gene name: | VDAC2 |
Gene alias: | FLJ23841 |
Gene description: | voltage-dependent anion channel 2 |
Genbank accession: | BC000165 |
Immunogen: | VDAC2 (AAH00165, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA |
Protein accession: | AAH00165 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (57.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Western Blot analysis of VDAC2 expression in transfected 293T cell line by VDAC2 monoclonal antibody (M01), clone 3D2. Lane 1: VDAC2 transfected lysate(31.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |