VDAC2 monoclonal antibody (M01), clone 3D2 View larger

VDAC2 monoclonal antibody (M01), clone 3D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VDAC2 monoclonal antibody (M01), clone 3D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about VDAC2 monoclonal antibody (M01), clone 3D2

Brand: Abnova
Reference: H00007417-M01
Product name: VDAC2 monoclonal antibody (M01), clone 3D2
Product description: Mouse monoclonal antibody raised against a full-length recombinant VDAC2.
Clone: 3D2
Isotype: IgG2a Kappa
Gene id: 7417
Gene name: VDAC2
Gene alias: FLJ23841
Gene description: voltage-dependent anion channel 2
Genbank accession: BC000165
Immunogen: VDAC2 (AAH00165, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Protein accession: AAH00165
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007417-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (57.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00007417-M01-13-15-1.jpg
Application image note: Western Blot analysis of VDAC2 expression in transfected 293T cell line by VDAC2 monoclonal antibody (M01), clone 3D2.

Lane 1: VDAC2 transfected lysate(31.6 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VDAC2 monoclonal antibody (M01), clone 3D2 now

Add to cart