VDAC1 monoclonal antibody (M17), clone 2E10 View larger

VDAC1 monoclonal antibody (M17), clone 2E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VDAC1 monoclonal antibody (M17), clone 2E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about VDAC1 monoclonal antibody (M17), clone 2E10

Brand: Abnova
Reference: H00007416-M17
Product name: VDAC1 monoclonal antibody (M17), clone 2E10
Product description: Mouse monoclonal antibody raised against a full-length recombinant VDAC1.
Clone: 2E10
Isotype: IgG2a Kappa
Gene id: 7416
Gene name: VDAC1
Gene alias: MGC111064|PORIN|PORIN-31-HL
Gene description: voltage-dependent anion channel 1
Genbank accession: BC008482
Immunogen: VDAC1 (AAH08482.1, 156 a.a. ~ 276 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLG
Protein accession: AAH08482.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007416-M17-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.94 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007416-M17-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to VDAC1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VDAC1 monoclonal antibody (M17), clone 2E10 now

Add to cart