VDAC1 monoclonal antibody (M05), clone 4C4 View larger

VDAC1 monoclonal antibody (M05), clone 4C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VDAC1 monoclonal antibody (M05), clone 4C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about VDAC1 monoclonal antibody (M05), clone 4C4

Brand: Abnova
Reference: H00007416-M05
Product name: VDAC1 monoclonal antibody (M05), clone 4C4
Product description: Mouse monoclonal antibody raised against a partial recombinant VDAC1.
Clone: 4C4
Isotype: IgG2a Kappa
Gene id: 7416
Gene name: VDAC1
Gene alias: MGC111064|PORIN|PORIN-31-HL
Gene description: voltage-dependent anion channel 1
Genbank accession: BC008482
Immunogen: VDAC1 (AAH08482, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD
Protein accession: AAH08482
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007416-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007416-M05-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged VDAC1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VDAC1 monoclonal antibody (M05), clone 4C4 now

Add to cart