Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of USF2 monoclonal antibody (M03), clone 6A9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about USF2 monoclonal antibody (M03), clone 6A9
| Brand: | Abnova |
| Reference: | H00007392-M03 |
| Product name: | USF2 monoclonal antibody (M03), clone 6A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant USF2. |
| Clone: | 6A9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7392 |
| Gene name: | USF2 |
| Gene alias: | FIP|bHLHb12 |
| Gene description: | upstream transcription factor 2, c-fos interacting |
| Genbank accession: | NM_003367 |
| Immunogen: | USF2 (NP_003358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVS |
| Protein accession: | NP_003358 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | USF2 monoclonal antibody (M03), clone 6A9. Western Blot analysis of USF2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | GSK3β-Dependent Phosphorylation Alters DNA Binding, Transactivity and Half-Life of the Transcription Factor USF2.Horbach T, Chi TF, Gotz C, Sharma S, Juffer AH, Dimova EY, Kietzmann T PLoS One. 2014 Sep 19;9(9):e107914. doi: 10.1371/journal.pone.0107914. eCollection 2014. |