USF2 monoclonal antibody (M02), clone 5F2 View larger

USF2 monoclonal antibody (M02), clone 5F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USF2 monoclonal antibody (M02), clone 5F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about USF2 monoclonal antibody (M02), clone 5F2

Brand: Abnova
Reference: H00007392-M02
Product name: USF2 monoclonal antibody (M02), clone 5F2
Product description: Mouse monoclonal antibody raised against a partial recombinant USF2.
Clone: 5F2
Isotype: IgG2a Kappa
Gene id: 7392
Gene name: USF2
Gene alias: FIP|bHLHb12
Gene description: upstream transcription factor 2, c-fos interacting
Genbank accession: NM_003367
Immunogen: USF2 (NP_003358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVS
Protein accession: NP_003358
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007392-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00007392-M02-1-25-1.jpg
Application image note: USF2 monoclonal antibody (M02), clone 5F2. Western Blot analysis of USF2 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy USF2 monoclonal antibody (M02), clone 5F2 now

Add to cart