UROD monoclonal antibody (M01A), clone 1G4 View larger

UROD monoclonal antibody (M01A), clone 1G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UROD monoclonal antibody (M01A), clone 1G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about UROD monoclonal antibody (M01A), clone 1G4

Brand: Abnova
Reference: H00007389-M01A
Product name: UROD monoclonal antibody (M01A), clone 1G4
Product description: Mouse monoclonal antibody raised against a partial recombinant UROD.
Clone: 1G4
Isotype: IgG2a Kappa
Gene id: 7389
Gene name: UROD
Gene alias: PCT
Gene description: uroporphyrinogen decarboxylase
Genbank accession: NM_000374
Immunogen: UROD (NP_000365, 268 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
Protein accession: NP_000365
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007389-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007389-M01A-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged UROD is approximately 1ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UROD monoclonal antibody (M01A), clone 1G4 now

Add to cart