Brand: | Abnova |
Reference: | H00007372-M05 |
Product name: | UMPS monoclonal antibody (M05), clone 2F5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UMPS. |
Clone: | 2F5 |
Isotype: | IgG2b Kappa |
Gene id: | 7372 |
Gene name: | UMPS |
Gene alias: | OPRT |
Gene description: | uridine monophosphate synthetase |
Genbank accession: | NM_000373 |
Immunogen: | UMPS (NP_000364, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG |
Protein accession: | NP_000364 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged UMPS is approximately 0.1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Predictive and prognostic markers for the outcome of chemotherapy in advanced colorectal cancer, a retrospective analysis of the phase III randomised CAIRO study.Koopman M, Venderbosch S, van Tinteren H, Ligtenberg MJ, Nagtegaal I, Van Krieken JH, Punt CJ. Eur J Cancer. 2009 Jul;45(11):1999-2006. Epub 2009 May 18. |