Brand: | Abnova |
Reference: | H00007327-D01P |
Product name: | UBE2G2 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human UBE2G2 protein. |
Gene id: | 7327 |
Gene name: | UBE2G2 |
Gene alias: | UBC7 |
Gene description: | ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast) |
Genbank accession: | NM_182688.1 |
Immunogen: | UBE2G2 (NP_872630.1, 1 a.a. ~ 137 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL |
Protein accession: | NP_872630.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | UBE2G2 MaxPab rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in mouse kidney. |
Applications: | WB-Ce,WB-Ti,IF |
Shipping condition: | Dry Ice |