Brand: | Abnova |
Reference: | H00007326-M01 |
Product name: | UBE2G1 monoclonal antibody (M01), clone 1C12-1B2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant UBE2G1. |
Clone: | 1C12-1B2 |
Isotype: | IgG1 kappa |
Gene id: | 7326 |
Gene name: | UBE2G1 |
Gene alias: | E217K|UBC7|UBE2G |
Gene description: | ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast) |
Genbank accession: | BC002775 |
Immunogen: | UBE2G1 (AAH02775, 1 a.a. ~ 170 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE |
Protein accession: | AAH02775 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (44.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to UBE2G1 on HeLa cell. [antibody concentration 20 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |