UBE2G1 monoclonal antibody (M01), clone 1C12-1B2 View larger

UBE2G1 monoclonal antibody (M01), clone 1C12-1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2G1 monoclonal antibody (M01), clone 1C12-1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about UBE2G1 monoclonal antibody (M01), clone 1C12-1B2

Brand: Abnova
Reference: H00007326-M01
Product name: UBE2G1 monoclonal antibody (M01), clone 1C12-1B2
Product description: Mouse monoclonal antibody raised against a full length recombinant UBE2G1.
Clone: 1C12-1B2
Isotype: IgG1 kappa
Gene id: 7326
Gene name: UBE2G1
Gene alias: E217K|UBC7|UBE2G
Gene description: ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast)
Genbank accession: BC002775
Immunogen: UBE2G1 (AAH02775, 1 a.a. ~ 170 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Protein accession: AAH02775
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007326-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (44.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007326-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to UBE2G1 on HeLa cell. [antibody concentration 20 ug/ml]
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UBE2G1 monoclonal antibody (M01), clone 1C12-1B2 now

Add to cart