Brand: | Abnova |
Reference: | H00007325-M01 |
Product name: | UBE2E2 monoclonal antibody (M01), clone 4B4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant UBE2E2. |
Clone: | 4B4 |
Isotype: | IgG1 Kappa |
Gene id: | 7325 |
Gene name: | UBE2E2 |
Gene alias: | FLJ25157|UBCH8 |
Gene description: | ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast) |
Genbank accession: | BC022332 |
Immunogen: | UBE2E2 (AAH22332, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT |
Protein accession: | AAH22332 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (47.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged UBE2E2 is approximately 0.03ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |