Brand: | Abnova |
Reference: | H00007323-M03 |
Product name: | UBE2D3 monoclonal antibody (M03), clone S2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant UBE2D3. |
Clone: | S2 |
Isotype: | IgG1 Kappa |
Gene id: | 7323 |
Gene name: | UBE2D3 |
Gene alias: | E2(17)KB3|MGC43926|MGC5416|UBC4/5|UBCH5C |
Gene description: | ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) |
Genbank accession: | BC003395 |
Immunogen: | UBE2D3 (AAH03395, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
Protein accession: | AAH03395 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (41.91 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |