UBE2D2 monoclonal antibody (M02), clone 4A1 View larger

UBE2D2 monoclonal antibody (M02), clone 4A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2D2 monoclonal antibody (M02), clone 4A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about UBE2D2 monoclonal antibody (M02), clone 4A1

Brand: Abnova
Reference: H00007322-M02
Product name: UBE2D2 monoclonal antibody (M02), clone 4A1
Product description: Mouse monoclonal antibody raised against a partial recombinant UBE2D2.
Clone: 4A1
Isotype: IgG2a Kappa
Gene id: 7322
Gene name: UBE2D2
Gene alias: E2(17)KB2|PUBC1|UBC4|UBC4/5|UBCH5B
Gene description: ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)
Genbank accession: NM_003339
Immunogen: UBE2D2 (NP_003330, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWS
Protein accession: NP_003330
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007322-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00007322-M02-1-8-1.jpg
Application image note: UBE2D2 monoclonal antibody (M02), clone 4A1 Western Blot analysis of UBE2D2 expression in NIH/3T3 ( Cat # L018V1 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: A 4-gene signature predicts survival of patients with resected adenocarcinoma of the esophagus, junction, and gastric cardia.Peters CJ, Rees JR, Hardwick RH, Hardwick JS, Vowler SL, Ong CA, Zhang C, Save V, O'Donovan M, Rassl D, Alderson D, Caldas C, Fitzgerald RC, OCCAMS Study Group.
Gastroenterology (2009), doi: 10.1053/ j.gastro.2010.05.080.

Reviews

Buy UBE2D2 monoclonal antibody (M02), clone 4A1 now

Add to cart