UBE2D1 polyclonal antibody (A01) View larger

UBE2D1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2D1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about UBE2D1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00007321-A01
Product name: UBE2D1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant UBE2D1.
Gene id: 7321
Gene name: UBE2D1
Gene alias: E2(17)KB1|SFT|UBC4/5|UBCH5|UBCH5A
Gene description: ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)
Genbank accession: NM_003338
Immunogen: UBE2D1 (NP_003329, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS
Protein accession: NP_003329
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007321-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.45 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Exposure to cigarette smoke induces overexpression of von Hippel-Lindau tumor suppressor in mouse skeletal muscle.Basic VT, Tadele E, Elmabsout AA, Yao H, Rahman I, Sirsjo A, Abdel-Halim SM.
Am J Physiol Lung Cell Mol Physiol. 2012 Sep;303(6):L519-27. Epub 2012 Jul 27.

Reviews

Buy UBE2D1 polyclonal antibody (A01) now

Add to cart