Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00007320-M06 |
Product name: | UBE2B monoclonal antibody (M06), clone 4C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2B. |
Clone: | 4C3 |
Isotype: | IgG2a Kappa |
Gene id: | 7320 |
Gene name: | UBE2B |
Gene alias: | E2-17kDa|HHR6B|HR6B|RAD6B|UBC2 |
Gene description: | ubiquitin-conjugating enzyme E2B (RAD6 homolog) |
Genbank accession: | NM_003337 |
Immunogen: | UBE2B (NP_003328.1, 63 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS |
Protein accession: | NP_003328.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of UBE2B expression in transfected 293T cell line by UBE2B monoclonal antibody (M06), clone 4C3. Lane 1: UBE2B transfected lysate(17.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |