Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TYK2 monoclonal antibody (M02), clone 5A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,ELISA |
More info about TYK2 monoclonal antibody (M02), clone 5A4
| Brand: | Abnova |
| Reference: | H00007297-M02 |
| Product name: | TYK2 monoclonal antibody (M02), clone 5A4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TYK2. |
| Clone: | 5A4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7297 |
| Gene name: | TYK2 |
| Gene alias: | JTK1 |
| Gene description: | tyrosine kinase 2 |
| Genbank accession: | BC014243 |
| Immunogen: | TYK2 (AAH14243, 276 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA |
| Protein accession: | AAH14243 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human leiomyosarcoma. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,ELISA |
| Shipping condition: | Dry Ice |