TXN monoclonal antibody (M01), clone 2A7 View larger

TXN monoclonal antibody (M01), clone 2A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TXN monoclonal antibody (M01), clone 2A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about TXN monoclonal antibody (M01), clone 2A7

Brand: Abnova
Reference: H00007295-M01
Product name: TXN monoclonal antibody (M01), clone 2A7
Product description: Mouse monoclonal antibody raised against a full length recombinant TXN.
Clone: 2A7
Isotype: IgG1 Kappa
Gene id: 7295
Gene name: TXN
Gene alias: DKFZp686B1993|MGC61975|TRX|TRX1
Gene description: thioredoxin
Genbank accession: BC003377
Immunogen: TXN (AAH03377, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Protein accession: AAH03377
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007295-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007295-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TXN on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice
Publications: Response of esophageal cancer cells to epigenetic inhibitors is mediated via altered thioredoxin activity.Ahrens TD, Timme S, Ostendorp J, Bogatyreva L, Hoeppner J, Hopt UT, Hauschke D, Werner M, Lassmann S.
Lab Invest. 2015 Dec 21. [Epub ahead of print]

Reviews

Buy TXN monoclonal antibody (M01), clone 2A7 now

Add to cart