Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TWIST1 monoclonal antibody (M13), clone 2G12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,IP |
More info about TWIST1 monoclonal antibody (M13), clone 2G12
| Brand: | Abnova |
| Reference: | H00007291-M13 |
| Product name: | TWIST1 monoclonal antibody (M13), clone 2G12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TWIST1. |
| Clone: | 2G12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7291 |
| Gene name: | TWIST1 |
| Gene alias: | ACS3|BPES2|BPES3|SCS|TWIST|bHLHa38 |
| Gene description: | twist homolog 1 (Drosophila) |
| Genbank accession: | NM_000474 |
| Immunogen: | TWIST1 (NP_000465.1, 106 a.a. ~ 174 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMAS |
| Protein accession: | NP_000465.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.22 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TWIST1 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | Deregulation of TWIST-1 in the CD34+ compartment represents a novel prognostic factor in chronic myeloid leukemia.Cosset E, Hamdan G, Jeanpierre S, Voeltzel T, Sagorny K, Hayette S, Mahon FX, Dumontet C, Puisieux A, Nicolini FE, Maguer-Satta V. Blood. 2011 Feb 3;117(5):1673-6. Epub 2010 Dec 1. |