Brand: | Abnova |
Reference: | H00007291-M10 |
Product name: | TWIST1 monoclonal antibody (M10), clone 4G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TWIST1. |
Clone: | 4G11 |
Isotype: | IgG2a Kappa |
Gene id: | 7291 |
Gene name: | TWIST1 |
Gene alias: | ACS3|BPES2|BPES3|SCS|TWIST|bHLHa38 |
Gene description: | twist homolog 1 (Drosophila) |
Genbank accession: | NM_000474 |
Immunogen: | TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH |
Protein accession: | NP_000465 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |