TWIST1 monoclonal antibody (M07), clone 4B4 View larger

TWIST1 monoclonal antibody (M07), clone 4B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TWIST1 monoclonal antibody (M07), clone 4B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about TWIST1 monoclonal antibody (M07), clone 4B4

Brand: Abnova
Reference: H00007291-M07
Product name: TWIST1 monoclonal antibody (M07), clone 4B4
Product description: Mouse monoclonal antibody raised against a partial recombinant TWIST1.
Clone: 4B4
Isotype: IgG2b Kappa
Gene id: 7291
Gene name: TWIST1
Gene alias: ACS3|BPES2|BPES3|SCS|TWIST|bHLHa38
Gene description: twist homolog 1 (Drosophila)
Genbank accession: NM_000474
Immunogen: TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
Protein accession: NP_000465
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007291-M07-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TWIST1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy TWIST1 monoclonal antibody (M07), clone 4B4 now

Add to cart