TWIST1 monoclonal antibody (M04), clone 3A2 View larger

TWIST1 monoclonal antibody (M04), clone 3A2

H00007291-M04_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TWIST1 monoclonal antibody (M04), clone 3A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about TWIST1 monoclonal antibody (M04), clone 3A2

Brand: Abnova
Reference: H00007291-M04
Product name: TWIST1 monoclonal antibody (M04), clone 3A2
Product description: Mouse monoclonal antibody raised against a partial recombinant TWIST1.
Clone: 3A2
Isotype: IgG1 Kappa
Gene id: 7291
Gene name: TWIST1
Gene alias: ACS3|BPES2|BPES3|SCS|TWIST|bHLHa38
Gene description: twist homolog 1 (Drosophila)
Genbank accession: NM_000474
Immunogen: TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
Protein accession: NP_000465
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007291-M04-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TWIST1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy TWIST1 monoclonal antibody (M04), clone 3A2 now

Add to cart