Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
Brand: | Abnova |
Reference: | H00007291-M01 |
Product name: | TWIST1 monoclonal antibody (M01), clone 3E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TWIST1. |
Clone: | 3E11 |
Isotype: | IgG1 Kappa |
Gene id: | 7291 |
Gene name: | TWIST1 |
Gene alias: | ACS3|BPES2|BPES3|SCS|TWIST|bHLHa38 |
Gene description: | twist homolog 1 (Drosophila) |
Genbank accession: | NM_000474 |
Immunogen: | TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH |
Protein accession: | NP_000465 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Western Blot analysis of TWIST1 expression in transfected 293T cell line by TWIST1 monoclonal antibody (M01), clone 3E11. Lane 1: TWIST1 transfected lysate(21 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | Cellular migration and invasion uncoupled: Increased migration is not an inexorable consequence of EMT.Schaeffer D, Somarelli JA, Hanna G, Palmer GM, Garcia-Blanco MA Mol Cell Biol. 2014 Jul 7. pii: MCB.00694-14. |