TWIST1 purified MaxPab mouse polyclonal antibody (B01P) View larger

TWIST1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TWIST1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about TWIST1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00007291-B01P
Product name: TWIST1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TWIST1 protein.
Gene id: 7291
Gene name: TWIST1
Gene alias: ACS3|BPES2|BPES3|SCS|TWIST|bHLHa38
Gene description: twist homolog 1 (Drosophila)
Genbank accession: NM_000474.3
Immunogen: TWIST1 (NP_000465.1, 1 a.a. ~ 202 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
Protein accession: NP_000465.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007291-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TWIST1 expression in transfected 293T cell line (H00007291-T01) by TWIST1 MaxPab polyclonal antibody.

Lane1:TWIST1 transfected lysate(22.22 KDa).
Lane2:Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TWIST1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart