Brand: | Abnova |
Reference: | H00007267-M09 |
Product name: | TTC3 monoclonal antibody (M09), clone 2D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TTC3. |
Clone: | 2D10 |
Isotype: | IgG2a Kappa |
Gene id: | 7267 |
Gene name: | TTC3 |
Gene alias: | DCRR1|DKFZp686M0150|RNF105|TPRDIII |
Gene description: | tetratricopeptide repeat domain 3 |
Genbank accession: | NM_003316 |
Immunogen: | TTC3 (NP_003307, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCV |
Protein accession: | NP_003307 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TTC3 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |