DNAJC7 polyclonal antibody (A01) View larger

DNAJC7 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAJC7 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DNAJC7 polyclonal antibody (A01)

Brand: Abnova
Reference: H00007266-A01
Product name: DNAJC7 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant DNAJC7.
Gene id: 7266
Gene name: DNAJC7
Gene alias: DANJC7|DJ11|TPR2|TTC2
Gene description: DnaJ (Hsp40) homolog, subfamily C, member 7
Genbank accession: BC033772
Immunogen: DNAJC7 (AAH33772, 1 a.a. ~ 484 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG
Protein accession: AAH33772
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007266-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (79.35 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DNAJC7 polyclonal antibody (A01) now

Add to cart