Brand: | Abnova |
Reference: | H00007265-M01 |
Product name: | TTC1 monoclonal antibody (M01), clone 4E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TTC1. |
Clone: | 4E3 |
Isotype: | IgG2b Kappa |
Gene id: | 7265 |
Gene name: | TTC1 |
Gene alias: | FLJ46404|TPR1 |
Gene description: | tetratricopeptide repeat domain 1 |
Genbank accession: | NM_003314 |
Immunogen: | TTC1 (NP_003305, 193 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LRRAELYEKTDKLDEALEDYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR |
Protein accession: | NP_003305 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunoperoxidase of monoclonal antibody to TTC1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1.5 ug/ml] |
Applications: | IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |