TRIP6 purified MaxPab mouse polyclonal antibody (B01P) View larger

TRIP6 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIP6 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about TRIP6 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00007205-B01P
Product name: TRIP6 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TRIP6 protein.
Gene id: 7205
Gene name: TRIP6
Gene alias: MGC10556|MGC10558|MGC29959|MGC3837|MGC4423|OIP1|ZRP-1
Gene description: thyroid hormone receptor interactor 6
Genbank accession: NM_003302.2
Immunogen: TRIP6 (NP_003293.2, 1 a.a. ~ 476 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
Protein accession: NP_003293.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007205-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TRIP6 expression in transfected 293T cell line (H00007205-T01) by TRIP6 MaxPab polyclonal antibody.

Lane 1: TRIP6 transfected lysate(52.36 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TRIP6 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart