TRIP6 polyclonal antibody (A01) View larger

TRIP6 polyclonal antibody (A01)

H00007205-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIP6 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TRIP6 polyclonal antibody (A01)

Brand: Abnova
Reference: H00007205-A01
Product name: TRIP6 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TRIP6.
Gene id: 7205
Gene name: TRIP6
Gene alias: MGC10556|MGC10558|MGC29959|MGC3837|MGC4423|OIP1|ZRP-1
Gene description: thyroid hormone receptor interactor 6
Genbank accession: NM_003302
Immunogen: TRIP6 (NP_003293, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLL
Protein accession: NP_003293
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007205-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: c-Src-mediated phosphorylation of thyroid hormone receptor-interacting protein 6 (TRIP6) promotes osteoclast sealing zone formation.McMichael BK, Meyer SM, Lee BS.
J Biol Chem. 2010 Aug 20;285(34):26641-51. Epub 2010 Jun 14.

Reviews

Buy TRIP6 polyclonal antibody (A01) now

Add to cart