Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00007182-M01 |
Product name: | NR2C2 monoclonal antibody (M01), clone 2A5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NR2C2. |
Clone: | 2A5 |
Isotype: | IgG1 Kappa |
Gene id: | 7182 |
Gene name: | NR2C2 |
Gene alias: | TAK1|TR2R1|TR4|hTAK1 |
Gene description: | nuclear receptor subfamily 2, group C, member 2 |
Genbank accession: | NM_003298 |
Immunogen: | NR2C2 (NP_003289, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVS |
Protein accession: | NP_003289 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NR2C2 expression in transfected 293T cell line by NR2C2 monoclonal antibody (M01), clone 2A5. Lane 1: NR2C2 transfected lysate(65.414 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |