NR2C2 polyclonal antibody (A01) View larger

NR2C2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NR2C2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about NR2C2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00007182-A01
Product name: NR2C2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NR2C2.
Gene id: 7182
Gene name: NR2C2
Gene alias: TAK1|TR2R1|TR4|hTAK1
Gene description: nuclear receptor subfamily 2, group C, member 2
Genbank accession: NM_003298
Immunogen: NR2C2 (NP_003289, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVS
Protein accession: NP_003289
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007182-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007182-A01-1-25-1.jpg
Application image note: NR2C2 polyclonal antibody (A01), Lot # 051017JC01 Western Blot analysis of NR2C2 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NR2C2 polyclonal antibody (A01) now

Add to cart