Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TPT1 monoclonal antibody (M03), clone 2C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about TPT1 monoclonal antibody (M03), clone 2C4
| Brand: | Abnova |
| Reference: | H00007178-M03 |
| Product name: | TPT1 monoclonal antibody (M03), clone 2C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TPT1. |
| Clone: | 2C4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7178 |
| Gene name: | TPT1 |
| Gene alias: | FLJ27337|HRF|TCTP|p02 |
| Gene description: | tumor protein, translationally-controlled 1 |
| Genbank accession: | BC022436 |
| Immunogen: | TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC |
| Protein accession: | AAH22436 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | TPT1 monoclonal antibody (M03), clone 2C4 Western Blot analysis of TPT1 expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Elevation of serum fortilin levels is specific for apoptosis and signifies cell death in vivo.Sinthujaroen P, Wanachottrakul N, Pinkaew D, Petersen JR, Phongdara A, Moore MS, Fujise K. BBA Clinical (2014), doi:10.1016/j.bbacli.2014.10.002 |