TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00007177-D01P
Product name: TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human TPSAB1 protein.
Gene id: 7177
Gene name: TPSAB1
Gene alias: MCP7|TPS1|TPS2|TPSB1
Gene description: tryptase alpha/beta 1
Genbank accession: NM_003294
Immunogen: TPSAB1 (NP_003285.2, 1 a.a. ~ 275 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Protein accession: NP_003285.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00007177-D01P-13-15-1.jpg
Application image note: Western Blot analysis of TPSAB1 expression in transfected 293T cell line (H00007177-T03) by TPSAB1 MaxPab polyclonal antibody.

Lane 1: TPSAB1 transfected lysate(30.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart