Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TPM4 monoclonal antibody (M01), clone 4E4-1D2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about TPM4 monoclonal antibody (M01), clone 4E4-1D2
| Brand: | Abnova |
| Reference: | H00007171-M01 |
| Product name: | TPM4 monoclonal antibody (M01), clone 4E4-1D2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TPM4. |
| Clone: | 4E4-1D2 |
| Isotype: | IgG1 kappa |
| Gene id: | 7171 |
| Gene name: | TPM4 |
| Gene alias: | - |
| Gene description: | tropomyosin 4 |
| Genbank accession: | BC037576 |
| Immunogen: | TPM4 (AAH37576, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI |
| Protein accession: | AAH37576 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.02 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TPM4 on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 2 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | LRRK2 guides the actin cytoskeleton at growth cones together with ARHGEF7 and Tropomyosin 4.Habig K, Gellhaar S, Heim B, Djuric V, Giesert F, Wurst W, Walter C, Hentrich T, Riess O, Bonin M Biochim Biophys Acta. 2013 Sep 24;1832(12):2352-2367. |