TPD52L1 purified MaxPab mouse polyclonal antibody (B02P) View larger

TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00007164-B02P
Product name: TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human TPD52L1 protein.
Gene id: 7164
Gene name: TPD52L1
Gene alias: D53|MGC8556|TPD52L2|hD53
Gene description: tumor protein D52-like 1
Genbank accession: NM_003287.2
Immunogen: TPD52L1 (NP_003278.1, 1 a.a. ~ 204 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
Protein accession: NP_003278.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007164-B02P-13-15-1.jpg
Application image note: Western Blot analysis of TPD52L1 expression in transfected 293T cell line (H00007164-T02) by TPD52L1 MaxPab polyclonal antibody.

Lane 1: TPD52L1 transfected lysate(22.44 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TPD52L1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart