TPBG (Human) Recombinant Protein (Q01) View larger

TPBG (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TPBG (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about TPBG (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00007162-Q01
Product name: TPBG (Human) Recombinant Protein (Q01)
Product description: Human TPBG partial ORF ( NP_006661, 219 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 7162
Gene name: TPBG
Gene alias: 5T4|5T4-AG|M6P1
Gene description: trophoblast glycoprotein
Genbank accession: NM_006670
Immunogen sequence/protein sequence: SNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEK
Protein accession: NP_006661
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00007162-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TPBG (Human) Recombinant Protein (Q01) now

Add to cart