TNNT3 polyclonal antibody (A01) View larger

TNNT3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNNT3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TNNT3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00007140-A01
Product name: TNNT3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TNNT3.
Gene id: 7140
Gene name: TNNT3
Gene alias: AMCD2B|DA2B|DKFZp779M2348|FSSV
Gene description: troponin T type 3 (skeletal, fast)
Genbank accession: NM_006757
Immunogen: TNNT3 (NP_006748, 161 a.a. ~ 258 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK
Protein accession: NP_006748
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007140-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNNT3 polyclonal antibody (A01) now

Add to cart