Brand: | Abnova |
Reference: | H00007132-A01 |
Product name: | TNFRSF1A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TNFRSF1A. |
Gene id: | 7132 |
Gene name: | TNFRSF1A |
Gene alias: | CD120a|FPF|MGC19588|TBP1|TNF-R|TNF-R-I|TNF-R55|TNFAR|TNFR1|TNFR55|TNFR60|p55|p55-R|p60 |
Gene description: | tumor necrosis factor receptor superfamily, member 1A |
Genbank accession: | NM_001065 |
Immunogen: | TNFRSF1A (NP_001056, 40 a.a. ~ 149 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLC |
Protein accession: | NP_001056 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |