TNFRSF1A polyclonal antibody (A01) View larger

TNFRSF1A polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF1A polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TNFRSF1A polyclonal antibody (A01)

Brand: Abnova
Reference: H00007132-A01
Product name: TNFRSF1A polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TNFRSF1A.
Gene id: 7132
Gene name: TNFRSF1A
Gene alias: CD120a|FPF|MGC19588|TBP1|TNF-R|TNF-R-I|TNF-R55|TNFAR|TNFR1|TNFR55|TNFR60|p55|p55-R|p60
Gene description: tumor necrosis factor receptor superfamily, member 1A
Genbank accession: NM_001065
Immunogen: TNFRSF1A (NP_001056, 40 a.a. ~ 149 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLC
Protein accession: NP_001056
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007132-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNFRSF1A polyclonal antibody (A01) now

Add to cart