CLEC3B MaxPab mouse polyclonal antibody (B01) View larger

CLEC3B MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLEC3B MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CLEC3B MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00007123-B01
Product name: CLEC3B MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CLEC3B protein.
Gene id: 7123
Gene name: CLEC3B
Gene alias: DKFZp686H17246|TN|TNA
Gene description: C-type lectin domain family 3, member B
Genbank accession: NM_003278.1
Immunogen: CLEC3B (NP_003269.1, 1 a.a. ~ 202 a.a) full-length human protein.
Immunogen sequence/protein sequence: MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
Protein accession: NP_003269.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007123-B01-13-15-1.jpg
Application image note: Western Blot analysis of CLEC3B expression in transfected 293T cell line (H00007123-T01) by CLEC3B MaxPab polyclonal antibody.

Lane 1: CLEC3B transfected lysate(22.22 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLEC3B MaxPab mouse polyclonal antibody (B01) now

Add to cart